This is an example of protein sequences in FASTA format.

> seq_1 comment for the first sequence. This line can be anything.
GQHIKQRWWLLVHYQPGXKKPKLAFGIFEVWNLPDAFKCNKIWEIKWYCMNRS
SQMVIMXPRLMXPAPXSDWFEVMGKTWSRFRQNEWRERYHEWPVGADVDFPPDPSHFWGLNKLQXYKT
SMCIHRMWCDPLRGTRKEVYVMPXWXLVCVLXDSCLNNCKKTWWHSPYILN
FAKPKFGNFSQXHLDICKRRAXXQRQAKFHVTGEMHAMPYNRAWEARRRVKTFWWTINKFG
XVPYFENLVAAKIRVXIELLXSNEFKKAFKRDVNEMNLEELCFCNTYMSHFXNPVNGWTHGQNCIX
MAFSNPFYQQTIAQFNAFXYDIDLPFGINXKTAYLRGKKSQIAMYIPXMYPVCKNK
AAPNLGXHYWCKGNQREXVQVFNSWDPXMRNMAKIRXCRXSVDFRFRAMQYGXHIHPXENKTDVDFRDHXNC
FGQRVGYQRDISGFNCXMFVTWTNMLRMIHCSCNYKAKMSEHIQWCLGA
ICKQDRMWGXMMVFIIMNYMHHNHTPRNIGYRNLMTCIKNEWQRQTRLGKYYDPASACLMWFTEQ
ITWNLPACAEQEDDINPHRVAATKIXKAYATACYXRXDEGKCKAQDWKECYSWVKXLRC
> seq_2 comment for the second sequence. This line can be anything.
NFRNTMAHAKWGVWYTCFCDNLQWALXIEGXRPNXKXGYGXXXVD
STKAMRTRYAHXKYWQIRPAIQKYLMFTLYDHYYHYQKWVLTWPALIQCIDRFWFXDMISK
KQSGELGQDYRAHLWGRKDAFRGNHHIVFKSYXLVFVLCIEEHCHRVKDCLYVAHQKMTFDHYNDSYHQMINDNNFTMW
AMWNDEHKGITMIQSREGMXEXWDHWCLVYYCTDDCCGKSKQMWSSCNAPVANMLGSXDATCKIP
LFYPYFHFGEMEGERHVMYACCYTGCKAAQYVTPCAXRLNKHMXSHRNCEIVSWQILDLLYHHIWIXSIXQAQG
FTDWWAPTYMEDRMIIRVYPHCEGKVWHSXSMNRDHNHDFVACWSXKGKQKPNCHSQLWNL
WESXCGWGAWNVYNFFRNVNLXYWVQPQWXXTHDSEPPFHSWEDTSKEQYFESEXSRCKIDIFSIGKXIFQQLQ
CPPYATXRTHFYDHHKMMHDVNNAHYSILVLSTNQSMWAYPMIIAHEDCKEGXIFRGXFFVLHYFKEAHEESNHRXPNGMPWR
LPWPVYQENPVKSALVFTVMEGMRFHMAXCNTTXKLYKVKMILAGRMIWNPIMSNCNW
> seq_3 comment for the third sequence. This line can be anything.
DIWCLWGGTKSSRLKLKXAAYATAAYXRHRKVAAPCDRFHCMMFHRCPWAWNIDAQERMGEPEFSWPYWHSFTRGKNE
TXIFYLTSQSRGYMAWPDVRXHFQVYPEGVNRRMAKSDNRKMNAFYWCLGPCSFFCQSIHHQSQSGKGQYPHDALAVQFKGIETHR
CHCEIWVKPWXIWQMLYVDIVGYTMFVFNLWDFHFDHHTAMRWWLEEWQTPRSXQFXGATIFNL
XHGXDGMHQSLFPQHFXMXLRIQHEDTMVWEVIRXSXIWMMCKLTMLGPQVQCLCKNTDDFNRFAEAECQWEQNFXGWYGH
GELEISMITWWPIMGLHCTSYVCKESMXYCWMFHXFYASHTFETMIGYLSDAPLESICMSPHXLSEYFGAHKFWVAELTNSPCXQWXVCWHWIMIHTK
AWVTIRRPSIXVWCLXYDAKFFACYFCQAMNNDFQREMFEIXLFIEHXDSFYNALQFKNGEXTYFEVFDPIGI
EMKYRYRRIYKLGAKTSVRYAPFKLXNMRCVXHPCDCYDRINWICNIRLHXXHENCMCADTMCIAWLKAFGCIGL
MLQVYFSPEXEYHPAWKRYLVYKSRRIHQXYSANRMAPCNYLAWM
> seq_4 comment for the 4th sequence. This line can be anything.
XENYDMHHCKXCWGMFPDQFNCNYGKNGSWWSYNQQHLTLEFEHAATMQQPIMXTKWFGVMLCPIQXTESEHDWIXYWX
MYEWXMSRPKMVMLQKXTCYSLTVMEEMQSVQLKLYCIRKXFSXSACFNPRRNKGTEXSKCAKIXGDCDCMHYGMYIWA
QLGGASMPYWXYYHGKRQGTMEVCNCQENCRGCRLTGHFDTWYNSQSERGPPRTIISSSMLTRXTKENHDVTWMLVVCS
AASFPQYTTMGIHQYFLGXEMGMGXPFMDEPEXWEADLVARMCYYWSEXAAAVTPAYARKTIPMKISEMSEHEAIHRNI
LHTDTXXEQRMCCDDWRTCQCXYPHSGHQVMAVIMNGXKSNEQWQYHVGTMMCYKDPNIVSLQMTFNGQVYTILKGRHG
FPSILKKDANLMLHRVSDPLEWGMRRGSQTIAWVVISMCVAEXPTDVDXXKDRXNCLTTEENRRDHVFPCGGMNGHRVV
MTXWMXYTDCRYDXNTQMLMTIVQYTGIRESWKAWRWFNHXIXHQQTHPWGWYMRMRMPNLHFVPXWKRYLXMEKTTAG
MYXSDMINQVFFLRPDGKPLSHWQHNAIDSYGETWSTDMTGPWXEPV
> seq_5 comment for the 5th sequence. This line can be anything.
HDAMIDRYNNRQQSCMWXRKXKQAVAACYXRGCQCCQQXTLQPQMVRVPXQWEEMPWENVIEMWDHSXLEIWPRPYMKEYTFQRHX FQWVEHGGGACSHERSSFHSHLRDXDVPWRLHXLXCQGNPPHSMISFKDTWVDFPFVLTLSQVEIITQINYPLGHVELPSGGCKSYPMKV FICSKGAFFTHSYPGVWTRPAYWYEMIGQYKGXFXKHHEVCQRQNNLTAFDIFTXGDLGGNVFGPYYHDVEQRIFCHKLGTIXHMTAHDA QLYMGQHGAEDVAWLCRKNGYSMMKLWVIDARYCLNHSYWVVCILWPDVSYFGYNGFHLKTYLPHLWWKMPNKXCGSIQGFMHSXMQTPX TYSSLPAIRDRFWTCTKPWKICEPNLPWSKYTEXXDPLDIFFNFMVWMLPWNTTPLGEIQCKPCXDGQYSHLLKFVLQSDHNNNVPGNKK IEDNHDQPWTCWMNGRAMKSMITFNFVGTWFPRPRMLNFKRVVGANTVYMWXEXMIRWWMEQPKAGQMSRGQLCILQQKYFLRIVTHAWH IRTQYETWCSWXPTMSIYQRFLYYMDDSFMRTHHISQDDRSCHSSHALSKDLAAMFKQPVWCSQ
> seq_6 comment for the 6th sequence. This line can be anything.
NKQHWTPPTDEKPSVMHIVGNNPWPKACNECAVGFTSXXYIIGDCWHMQNTMTPHP
FLKHSVHRYGKSSKQWLYVGWINAYPLQPGVLHEPHENLFPKMRMNHHWNRWGQEX
ENGKHPTSDYYWWPAVYTWRDCFVXGDFYNTTTQLRYTXKAYATPCAXRXARGKKDQYGG
DHEMAHGSLDILKGRKCTVWRFKMLCCSATMHVSQEHPQGKXAYTXXMNPIHQAHDLCVDR
EHWQREICXSCFSVDYFQHGTPDKINWQHFXNADNHCQNIMERGMTHMPLTEXYHWVILDMAAAYFXYT
DWCWKSKWLPSRXRYDINAGCMTGIMEPPNGCRANHTQWXAKRIHMGQKFEAQVDYMYLYQWELFYYLS
GPGRPIPYTSLNDCAPGTDPSYINERYVTRVTELNGWNAXVFPSYVVVMKMGQHSWTXIDTLGDAWKDATEDIMEQGHG
VGTMHPSGWNCCHALLGIWESNGDIHNCCGCSKLPWWFYTKSSRNSDHQPASTQMDDPEICLSKILQEM